PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC17852_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 513aa    MW: 56821.6 Da    PI: 5.1501
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC17852_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.44.5e-154289148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +l+++v+++G g+W+++ +  g+ R++k+c++rw ++l
      RrC17852_p1 42 KGPWTSTEDGILINYVRKHGEGNWSAVHKLTGLARCGKSCRLRWANHL 89
                     79******************************************9986 PP

2Myb_DNA-binding47.44.4e-1595138146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+++++E+ l+v+ ++++G++ W++ a++++ gRt++++k++w++
      RrC17852_p1  95 KGAFSQDEERLIVQMHAKMGNK-WARMAERLP-GRTDNEIKNYWNT 138
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.1393789IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-224092IPR009057Homeodomain-like
SuperFamilySSF466892.66E-2841136IPR009057Homeodomain-like
SMARTSM007176.2E-114191IPR001005SANT/Myb domain
PfamPF002491.2E-134289IPR001005SANT/Myb domain
CDDcd001672.18E-94489No hitNo description
PROSITE profilePS5129424.12190144IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2393143IPR009057Homeodomain-like
SMARTSM007171.0E-1594142IPR001005SANT/Myb domain
PfamPF002495.3E-1495138IPR001005SANT/Myb domain
CDDcd001671.91E-1197138No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 513 aa     Download sequence    Send to blast
MSYTGESDDR MHHPSIYDES LSSPAGDNNI CRSRGKASVL KKGPWTSTED GILINYVRKH  60
GEGNWSAVHK LTGLARCGKS CRLRWANHLR PNLKKGAFSQ DEERLIVQMH AKMGNKWARM  120
AERLPGRTDN EIKNYWNTRI KRRRRAGLPL YSPDIHVEDL ESSEEYITSN ITRVDRRRRQ  180
DCLLLGNPKA NDDVLFDDLN FATSLLPGAS DVSDMFECNM LVTVASSSPY ESYMPPILPS  240
PKQLQESGSL FPMCSSNIKQ ELHSPERFQN AASQKSPRSC SISPCDPPPY GNQHPSDVLI  300
PDNSHTFTDG MLLTSKPLFG AVKLELPSFQ YSETSEFDQW KTMTPSPPHS EDPLDSVDAY  360
IQSPPPLEIE ESSDTGLLDM LLHEAKIKTS AKRSLALPEI PVPTQLSAGD DNSPDSAGNV  420
VVKTEELDQV WEPKRVVDVT RPDVLLASSW LDQQGCFGIV SDSSSMSDAL ALLLGGGEHI  480
ENSYVTVESS SSGQAQQGVG SCTWTNMPPV WSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C8e-31391431104C-Myb DNA-Binding Domain
1mse_C8e-31391431104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013750130.10.0PREDICTED: transcription factor GAMYB isoform X1
RefseqXP_013750131.10.0PREDICTED: transcription factor GAMYB isoform X1
TrEMBLA0A078J1770.0A0A078J177_BRANA; BnaCnng31260D protein
STRINGBra034842.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.10.0myb domain protein 65